| Cata #: | Name of Product: | Price: |
| HTF-0797 | Recombinant Human ZNF581 Protein | $300 |

| Product Name: | Recombinant Human ZNF581 Protein |
| Catalog #: | HTF-0797 |
| Manufacture: | LD Biopharma, Inc. |
| Intruduction: | Human ZNF581 belongs to Zinc finger protein family, which carries 4 C2H2-type 1 zinc finger domain. (ZNF domain). Function of human ZNF581currently is unknown, it was predicted to have transcription regulation activity. ZNF581 mRNA was dominantly expressed in Astrocytes, CD14+ monocytes and CD34+ cells. Full-length human ZNF581 (197 aa) gene was constructed with 15 aa N-terminal T7 tag and expressed in E.coli as inclusion bodies, refolded using our unique “temperature shift inclusion body refolding” technology and chromatographically purified. |
| Gene Symbol: | ZNF581 (HSPC189) |
| Accession Number: | NP_057619 |
| Species: | Human |
| Package Size: | 50 µg / Vial |
| Composition: | 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol. |
| Storage: | In Liquid. Keep at -20°C for long term storage. Product is stable at 4 °C for at least 30 days. |
| Key Reference: | QH Zhang, et al., Cloning and functional analysis of cDNAs with open reading frames for 300 previously undefined genes expressed in CD34+ hematopoietic stem/progenitor cells. Genome Res. Oct;10 (10): 1546-1560. (2000). |
| Applications: | 1. May be used for in vitro CD34 cell differentiation regulation study using recombinant ZNF581 protein intracellular delivery method. 2. May be used as enzymatic substrate protein for Kinase and ubiquitin assay development. 3. May be used for mapping ZNF581 protein–protein interaction. 4. May be used as antigen for specific antibody development. |
| Quality Control: | 1. Purity: > 90% by SDS-PAGE. |
| Recombinant Protein Sequence: | MASMTGGQQMGRGEFMLVLPSPCPQPLAFSSVETMEGPPRRTCRSPEPGPSSSIGSPQASSPPRPNHYLLIDTQGVPYTVLVDEESQREPGASGAPGQKKCYSCPVCSRVFEYMSYLQRHSITHSEVKPFECDICGKAFKRASHLARHHSIHLAGGGRPHGCPLCPRRFRDAGELAQHSRVHSGERPFQCPHCPRRFMEQNTLQKHTRWKHP Download Datasheet |