Invention in the REGENERATIVE MEDICINE is what we do every day, benefits of patients is our final goal
| Cata #: | Name of Product: | Price: |
| HRP-3610 | Recombinant Human ZNRF3 Extracellular Domain Protein | $250 |
| Product Name: | Recombinant Human ZNRF3 Extracellular Domain Protein |
| Catalog #: | HRP-3610 |
| Manufacture: | LD Biopharma, Inc. |
| Intruduction: | Human E3 ubiquitin-protein ligase ZNRF3 gene encodes a single pass type I membrane protein and function as E3 ubiquitin-protein ligase that acts as a negative regulatorof the Wnt signaling pathway by mediating the ubiquitination and subsequent degradation of Wnt receptor complex components Frizzled and LRP6. It acts on both canonical and non-canonical Wnt signaling pathway. ZNRF3 acts as a tumor suppressor in the intestinal stem cell zone by inhibiting the Wnt signaling pathway, thereby restricting the size of the intestinal stem cell zone. Full-length extracellular domain of human ZNRF3 cDNA (56 – 219aa) was constructed with codon optimization gene synthesis and expressed with N-terminalT7-His-TEV cleavage site Tag (29aa) fusion. This protein was expressed in E. coli as soluble protein and purified using affinity column. |
| Gene Symbol: | ZNRF3 ( RNF203; KIAA1133 ) |
| Accession Number: | NP_001193927.1 |
| Species: | Human |
| Package Size: | 20 µg / Vial |
| Composition: | 0.2 mg/ml, sterile-filtered, in 20% Glycerol with PBS buffer & 1mM DTT. |
| Storage: | In Liquid. Keep at -80°C for long term storage. Product is stable at 4 °C for at least 30 days. |
| Key Reference: | Fraser M, et al.,Somatic driver mutation prevalence in 1844 prostate cancersidentifies ZNRF3 loss as a predictor of metastatic relapse. Nat Commun 12 (1), 6248 (2021) Wang Z, et al., RSPO2 silence inhibits tumorigenesis of nasopharyngeal carcinoma byZNRF3/Hedgehog-Gli1 signal pathway. Life Sci 282, 119817 (2021) Kim M, et al., A MET-PTPRK kinase-phosphatase rheostat controls ZNRF3 and Wntsignaling. Elife 10, e70885 (2021) Xie Y, et al., Interaction with both ZNRF3 and LGR4 is required for the signalingactivity of R-spondin. EMBO Rep 14 (12), 1120-1126 (2013) |
| Applications: |
|
| Quality Control: | Purity: > 92% by SDS-PAGE. |
| Recombinant Protein Sequence: | MASMTGGQQMGRGHHHHHHENLYFQGGEFGSKETAFVEVVLFESSPSGDYTTYTTGLTGRFSRAGATLSAEGEIVQMHPLGLCNNNDEEDLYEYGWVGVVKLEQPELDPKPCLTVLGKAKRAVQRGATAVIFDVSENPEAIDQLNQGSEDPLKRPVVYVKGADAIKLMNIVNKQKVARARIQHRPPRQPTEYFDM |