Invention in the REGENERATIVE MEDICINE is what we do every day, benefits of patients is our final goal
| Cata #: | Name of Product: | Price: |
| HRP-2159 | Recombinant Human BECN1 Protein | $200 |
| Product Name: | Recombinant Human BECN1 Protein |
| Catalog #: | HRP-2159 |
| Manufacture: | LD Biopharma, Inc. |
| Intruduction: | Human Beclin-1 (BECN1) plays a central role in autophagy pathway. It acts as core subunit of the PI3K complex that mediates formation of phosphatidylinositol 3-phosphate; different complex forms are believed to play a role in multiple membrane trafficking pathways: PI3KC3-C1 is involved in initiation of autophagosomes and PI3KC3-C2 in maturation of autophagosomes and endocytosis. BECN1 is involved in regulation of degradative endocytic trafficking and required for the abcission step in cytokinesis, probably in the context of PI3KC3-C2. It is essential for the formation of PI3KC3-C2 but not PI3KC3-C1 PI3K complex forms. BECN1 is also involved in endocytosis. It protects against infection by a neurovirulent strain of Sindbis virus. It may play a role in antiviral host defense Full-length human BECN1 cDNA (449aa, Isoform-I, derived from BC010276) was constructed with codon optimization gene synthesis and expressed with a human N-terminalT7-His-TEV cleavage site Tag (29aa) fusion. This protein was expressed in E. coli as inclusion bodies. The final product was refolded using our unique “temperature shift inclusion body refolding” technology and chromatographically purified. |
| Gene Symbol: | BECN1 (ATG6; Beclin1; VPS30) |
| Accession Number: | NP_003757 |
| Species: | Human |
| Package Size: | 30 µg / Vial |
| Composition: | 0.3 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose, DTT and other. |
| Storage: | In Liquid. Keep at -80°C for long term storage. Product is stable at 4 °C for at least 30 days. |
| Key Reference: | Bi C, et al.,High Beclin-1 and ARID1A expression corelates with poor survival and high recurrence in intrahepatic cholangiocarcinoma: a histopathological retrospective study. BMC Cancer 19 (1), 213 (2019)
Tamrakar S, et al., Clinicopathological Significance of Autophagy-related Proteins and its Association With Genetic Alterations in Gliomas. Anticancer Res. 39 (3), 1233-1242 (2019)
Chang C, et al., Bidirectional Control of Autophagy by BECN1 BARA Domain Dynamics. Mol. Cell 73 (2), 339-353 (2019)
Furuya N, et al., The evolutionarily conserved domain of Beclin 1 is required for Vps34 binding, autophagy and tumor suppressor function. Autophagy 1 (1), 46-52 (2005)
|
| Applications: |
|
| Quality Control: | Purity: > 92 % by SDS-PAGE. |
| Recombinant Protein Sequence: | MASMTGGQQMGRGHHHHHHENLYFQGGEFEGSKTSNNSTMQVSFVCQRCSQPLKLDTSFKILDRVTIQELTAPLLTTAQAKPGETQEEETNSGEEPFIETPRQDGVSRRFIPPARMMSTESANSFTLIGEASDGGTMENLSRRLKVTGDLFDIMSGQTDVDHPLCEECTDTLLDQLDTQLNVTENECQNYKRCLEILEQMNEDDSEQLQMELKELALEEERLIQELEDVEKNRKIVAENLEKVQAEAERLDQEEAQYQREYSEFKRQQLELDDELKSVENQMRYAQTQLDKLKKTNVFNATFHIWHSGQFGTINNFRLGRLPSVPVEWNEINAAWGQTVLLLHALANKMGLKFQRYRLVPYGNHSYLESLTDKSKELPLYCSGGLRFFWDNKFDHAMVAFLDCVQQFKEEVEKGETRFCLPYRMDVEKGKIEDTGGSGGSYSIKTQFN
SEEQWTKALKFMLTNLKWGLAWVSSQFYNK
Download Datasheet |