Invention in the REGENERATIVE MEDICINE is what we do every day, benefits of patients is our final goal
| Cata #: | Name of Product: | Price: |
| PRP-1985 | Recombinant Glym4 Protein | $300 |
| Product Name: | Recombinant Glym4 Protein |
| Catalog #: | PRP-1985 |
| Manufacture: | LD Biopharma, Inc. |
| Intruduction: | Glym 4 (Glycine max stress-induced protein SAM22) gene encodes a protein which is the major soy allergen for patients allergic to birch pollen with soy allergy. Full-length Glym4 gene (157aa) was constructed by codon-optimization gene synthesis technology with 29 aa N-terminal T7 / His / TEV cleavage site Tag. This protein was expressed in E. coli as inclusion bodies. The final product was refolded using our unique “temperature shift inclusion body refolding” technology and chromatographically purified. |
| Gene Symbol: | Glym4 (SAM22) |
| Accession Number: | P26987 |
| Species: | Glycine max (Soybean) |
| Package Size: | 25 µg / Vial |
| Composition: | 0.25 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT. |
| Storage: | In Liquid. Keep at -80°C for long term storage. Product is stable at 4 °C for at least 30 days. |
| Key Reference: | Mittag D, et al. Soybean allergy in patients allergic to birch pollen: clinical investigation and molecular characterization of allergens. J. Allergy Clin Immunol. 113: 148-154. (2004) |
| Applications: | 1. May be used as “ research ” reagent for allergic detection assay development. 2. As a native extracellular domain, may be used as immunogen for specific antibody production. |
| Quality Control: | Purity: > 90% by SDS-PAGE. |
| Recombinant Protein Sequence: | MASMTGGQQMGRGHHHHHHENLYFQGEFGVFTFEDEINSPVAPATLYKALVTDADNVIPKALDSFKSVENVEGNGGPGTIKKITFLEDGETKFVLHKIESIDEANLGYSYSVVGGAALPDTAEKITFDSKLVAGPNGGSAGKLTVKYETKGDAEPNQDELKTGKAKADALFKAIEAYLLAHPDYN Download Datasheet |