Invention in the REGENERATIVE MEDICINE is what we do every day, benefits of patients is our final goal
| Cata #: | Name of Product: | Price: |
| HRP-2076 | Recombinant Human Tetranectin Protein | $300 |
| Product Name: | Recombinant Human Tetranectin Protein |
| Catalog #: | HRP-2076 |
| Manufacture: | LD Biopharma, Inc. |
| Intruduction: | The protein encoded by human Tetranectin (TNA) belongs to the family of C-type lectin that bind specifically to Kringle four of plasminogen and is thought to have a role in the regulation of proteolytic and fibrinolysis process. It may be involved in the packaging of molecules destined for exocytosis. Tetranectin has been shown to co-localized with plasminogen at the invasion front of melanomas, suggesting a role in cancer invasion and metastases. Full-length human Tetranectin mature protein cDNA (23 – 220 aa) was constructed with codon optimization gene synthesis and expressed with a human N-terminalT7-His-TEV cleavage site Tag (29aa) fusion. This protein was expressed in E. coli as inclusion bodies. The final product was refolded using our unique “temperature shift inclusion body refolding” technology and chromatographically purified. |
| Gene Symbol: | TNA (CLEC3B; TN) |
| Accession Number: | NP_003269 |
| Species: | Human |
| Package Size: | 20 µg / Vial |
| Composition: | 0.2 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT. |
| Storage: | In Liquid. Keep at -80°C for long term storage. Product is stable at 4 °C for at least 30 days. |
| Key Reference: | Heeran MC, et al., Tetranectin positive expression in tumour tissue leads to longer survival in Danish women with ovarian cancer. Results from the 'Malova' ovarian cancer study. APMIS 123 (5), 401-409 (2015) Chen Y, et al., Tetranectin as a Potential Biomarker for Stable Coronary Artery Disease. Sci Rep 5, 17632 (2015) |
| Applications: | 1. May be used for in vitro Tetranectin mediated cancer cell adhesion / receptor pathway regulation study with this protein either as soluble factor or as coating matrix protein. 2. May be used for protein-protein interaction assay. 3. Potential biomarker protein, such as monitoring ovarian cancer prognosis. 4. As immunogen for specific antibody production. |
| Quality Control: | Purity: > 90% by SDS-PAGE. |
| Recombinant Protein Sequence: | MASMTGGQQMGRGHHHHHHENLYFQGGEFPPTQKPKKIVNAKKDVVNTKMFEELKSRLDTLAQEVALLKEQQALQTVCLKGTKVHMKCFLAFTQTKTFHEASEDCISRGGTLSTPQTGSENDALYEYLRQSVGNEAEIWLGLNDMAAEGTWVDMTGARIAYKNWETEITAQPDGGKTENCAVLSGAANGKWFDKRCRDQLPYICQFGIV Download Datasheet |