Invention in the REGENERATIVE MEDICINE is what we do every day, benefits of patients is our final goal
| Cata #: | Name of Product: | Price: |
| hRP-1821 | Recombinant Human CD352 Protein | $300 |
| Product Name: | Recombinant Human CD352 Protein |
| Catalog #: | hRP-1821 |
| Manufacture: | LD Biopharma, Inc. |
| Intruduction: | Human SLAM family member 6 (SLAMF6, also named as CD352) gene encodes a member of the CD2 family of cell surface proteins involved in lymphocyte activation. CD352 protein is expressed on (activated or resting) Natural killer (NK), T, and B lymphocytes. It undergoes tyrosine phosphorylation and associates with the Src homology 2 domain-containing protein (SH2D1A) as well as with SH2 domain-containing phosphatases (SHPs). It functions as a co-receptor in the process of NK cell activation. It can also mediate inhibitory signals in NK cells from X-linked lymphoproliferative patients. Extracellular domain of human CD352 cDNA ( 22 – 226aa, Isoform-I ) was constructed with codon optimization using gene synthesis technology and expressed with a small T7-His-TEV cleavage site Tag (29aa) fusion at its N-terminal. This protein was expressed in E. coli as inclusion bodies. The final product was refolded using our unique “temperature shift inclusion body refolding” technology and chromatographically purified. |
| Gene Symbol: | CD352 (SLAMF6; KALI; KALIb; Ly108; NTB-A; SF2000 |
| Accession Number: | NP_001171643 |
| Species: | Human |
| Package Size: | 50 µg / Vial |
| Composition: | 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT. |
| Storage: | In Liquid. Keep at -80°C for long term storage. Product is stable at 4 °C for at least 30 days. |
| Key Reference: | Bolduan S, et al., HIV-1 Vpu affects the anterograde transport and the glycosylation pattern of NTB-A. Virology 440 (2), 190-203 (2013) Chatterjee M, et al., CD3-T cell receptor co-stimulation through SLAMF3 and SLAMF6 receptors enhances RORgammat recruitment to the IL17A promoter in human T lymphocytes. J. Biol. Chem. 287 (45), 38168-38177 (2012) Chatterjee M, et al., Increased expression of SLAM receptors SLAMF3 and SLAMF6 in systemic lupus erythematosus T lymphocytes promotes Th17 Differentiation. J. Immunol. 188 (3), 1206-1212 (2012) Chatterjee M, et al., SLAMF6-driven co-stimulation of human peripheral T cells is defective in SLE T cells. Autoimmunity 44 (3), 211-218 (2011) |
| Applications: | 1. May be used for in vitro CD352 mediated T cell activities regulation study in IL17A pathway with this protein either as soluble factor or as coating matrix protein. 2. May be used for protein-protein interaction mapping. 3. Potential biomarker protein for monitoring T cell activity various auto-immuno-diseases. 4. As immunogen for specific antibody production. |
| Quality Control: | Purity: > 90% by SDS-PAGE. |
| Recombinant Protein Sequence: | MASMTGGQQMGRGHHHHHHENLYFQGGEFQSSLTPLMVNGILGESVTLPLEFPAGEKVNFITWLFNETSLAFIVPHETKSPEIHVTNPKQGKRLNFTQSYSLQLSNLKMEDTGSYRAQISTKTSAKLSSYTLRILRQLRNIQVTNHSQLFQNMTCELHLTCSVEDADDNVSFRWEALGNTLSSQPNLTVSWDPRISSEQDYTCIAENAVSNLSFSVSAQKLCEDVKIQYTDTKM Download Datasheet |