Invention in the REGENERATIVE MEDICINE is what we do every day, benefits of patients is our final goal
| Cata #: | Name of Product: | Price: |
| hRP-1772 | Recombinant Human IL1RL1 Protein | $300 |
| Product Name: | Recombinant Human IL1RL1 Protein |
| Catalog #: | hRP-1772 |
| Manufacture: | LD Biopharma, Inc. |
| Intruduction: | The protein encoded by human interleukin-1 receptor-like-1 (IL1RL1) gene encodes a receptor for IL-33, its stimulation recruits MYD88, IRAK1, IRAK4, and TRAF6, followed by phosphorylation of MAPK3/ERK1 and/or MAPK1/ERK2, MAPK14, and MAPK8. It is possibly involved in helper T-cell function. Recent data indicated that IL1RAP interacts with IL1RL1, and IL1RAP, and this interaction plays a role in Alzheimer pathogenesis. Full-length extracellular domain of human IL1RL1 cDNA (19 – 328aa, Isoform-II, derived from BC030975) was constructed with codon optimization and expressed with a small T7-His-TEV cleavage site Tag (29aa) fusion at its N-terminal. This protein was expressed in E. coli as inclusion bodies. The final product was refolded using our unique “temperature shift inclusion body refolding” technology and chromatographically purified. |
| Gene Symbol: | IL1RL1 (DER4; FIT-1; IL33R; ST2; ST2L; ST2V; T1) |
| Accession Number: | NP_003847 |
| Species: | Human |
| Package Size: | 50 µg / Vial |
| Composition: | 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT. |
| Storage: | In Liquid. Keep at -80°C for long term storage. Product is stable at 4 °C for at least 30 days. |
| Key Reference: | Vijay K Ramanan, et al., GWAS of longitudinal amyloid accumulation on 18F-florbetapir PET in Alzheimer’s disease implicates microglial activation gene IL1RAP. Brian. Vol 138, Issue 10. Pp3076-3088 (2015) Jilu Zhang, et al., ST2 blockade reduces sST2-producing T cells while maintaining protective mST-expressing T cells during graft-versus-host disease. Science Translation Medicine Vol:7,Issue 308. 308ra160 (2015). Ingrid Granne, et al., ST2 and IL-33 in pregnancy & Pre-Eclampsia. Plus ONE 6(9):e24463. (2011). Baba S, et al., Expression of IL-33 and its receptor ST2 in chronic rhinosinusitis with nasal polyps. Laryngoscope 124 (4), E115-E122 (2014) Tu X, et al., The IL-33-ST2L pathway is associated with coronary artery disease in a Chinese Han population. Am. J. Hum. Genet. 93 (4), 652-660 (2013) Ho JE, et al., Common genetic variation at the IL1RL1 locus regulates IL-33/ST2 signaling. J. Clin. Invest. 123 (10), 4208-4218 (2013) Liu X, et al., Structural insights into the interaction of IL-33 with its receptors. Proc. Natl. Acad. Sci. U.S.A. 110 (37), 14918-14923 (2013) |
| Applications: | 1. May be used for in vitro IL1RL1 mediated T cell activation in IL-33 regulatory pathway study with this protein either as soluble factor or as coating matrix protein. 2. May be used for mapping IL1RL1 protein-protein interaction. 3. Potential biomarker protein for diagnostic applications, such as preeclampsia or GVHD et al. 4. As immunogen for specific antibody production. |
| Quality Control: | Purity: > 90% by SDS-PAGE. |
| Recombinant Protein Sequence: | MASMTGGQQMGRGHHHHHHENLYFQGGEFGSKFSKQSWGLENEALIVRCPRQGKPSYTVDWYYSQTNKSIPTQERNRVFASGQLLKFLPAAVADSGIYTCIVRSPTFNRTGYANVTIYKKQSDCNVPDYLMYSTVSGSEKNSKIYCPTIDLYNWTAPLEWFKNCQALQGSRYRAHKSFLVIDNVMTEDAGDYTCKFIHNENGANYSVTATRSFTVKDEQGFSLFPVIGAPAQNEIKEVEIGKNANLTCSACFGKGTQFLAAVLWQLNGTKITDFGEPRIQQEEGQNQSFSNGLACLDMVLRIADVKEEDLLLQYDCLALNLHGLRRHTVRLSRKNPIDHHS Download Datasheet |