Invention in the REGENERATIVE MEDICINE is what we do every day, benefits of patients is our final goal
| Cata #: | Name of Product: | Price: |
| HRP-1647 | Recombinant Human TNFSF9 Protein | $300 |
| Product Name: | Recombinant Human TNFSF9 Protein |
| Catalog #: | HRP-1647 |
| Manufacture: | LD Biopharma, Inc. |
| Intruduction: | The protein encoded by human Tumor Necrosis Factor Ligand Superfamily member 9 (TNFSF9) gene is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. This transmembrane cytokine is a bidirectional signal transducer that acts as a ligand for TNFRSF9/4-1BB, which is a co-stimulatory receptor molecule in T lymphocytes. This cytokine and its receptor are involved in the antigen presentation process and in the generation of cytotoxic T cells. The receptor TNFRSF9/4-1BB is absent from resting T lymphocytes but rapidly expressed upon antigenic stimulation. The ligand encoded by this gene, TNFSF9/4-1BBL, has been shown to reactivate anergic T lymphocytes in addition to promoting T lymphocyte proliferation. This cytokine has also been shown to be required for the optimal CD8 responses in CD8 T cells. This cytokine is expressed in carcinoma cell lines, and is thought to be involved in T cell-tumor cell interaction. Full-length mature human TNFSF8 cDNA (50 – 254 aa) was constructed with fully codon optimization DNA synthesis strategy and expressed in non-fusion form as inclusion bodies.. The final product was refolded using our unique “temperature shift inclusion body refolding” technology and chromatographically purified. |
| Gene Symbol: | TNFSF9 (CD137L; 4-1BB-L) |
| Accession Number: | NP_003802 |
| Species: | Human |
| Package Size: | 25 µg / Vial |
| Composition: | 0.25 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT. |
| Storage: | In Liquid. Keep at -80°C for long term storage. Product is stable at 4 °C for at least 30 days. |
| Key Reference: | Ma J, et al., The TNF family member 4-1BBL sustains inflammation by interacting with TLR signaling components during late-phase activation. Sci Signal 6 (295), RA87 (2013) Moh MC, et al., Tumor necrosis factor receptor 1 associates with CD137 ligand and mediates its reverse signaling. FASEB J. 27 (8), 2957-2966 (2013) Zhao S, et al., CD137 ligand is expressed in primary and secondary lymphoid follicles and in B-cell lymphomas: diagnostic and therapeutic Implications. Am. J. Surg. Pathol. 37 (2), 250-258 (2013) Park SJ, et al., Reverse signaling through the co-stimulatory ligand, CD137L, as a critical mediator of sterile inflammation. Mol. Cells 33 (6), 533-537 (2012) Arch RH et al., 4-1BB and Ox40 are members of a tumor necrosis factor (TNF)-nerve growth factor receptor subfamily that bind TNF receptor-associated factors and activate nuclear factor kappaB. Mol. Cell. Biol. 18 (1), 558-565 (1998) |
| Applications: | 1. May be used for in vitro human TNFSF9 mediated T cell activation regulatory with this protein as either as soluble factor or as coating matrix. 2. May be used for specific antibody production. |
| Quality Control: | Purity: > 90% by SDS-PAGE. |
| Recombinant Protein Sequence: | MASMTGGQQMGRGHHHHHHENLYFQGEFACPWAVSGARASPGSAASPRLREGPELSPDDPAGLLDLRQGMFAQLVAQNVLLIDGPLSWYSDPGLAGVSLTGGLSYKEDTKELVVAKAGVYYVFFQLELRRVVAGEGSGSVSLALHLQPLRSAAGAAALALTVDLPPASSEARNSAFGFQGRLLHLSAGQRLGVHLHTEARARHAWQLTQGATVLGLFRVTPEIPAGLPSPRSE |