Invention in the REGENERATIVE MEDICINE is what we do every day, benefits of patients is our final goal

Our Products

Home > Products

Cata #: Name of Product: Price:
RP-0053 Recombinant GFP-9R Protein $160
img

Recombinant GFP-9R Protein

Product Name: Recombinant GFP-9R Protein
Catalog #:  RP-0053
Manufacture:  LD Biopharma, Inc.
Intruduction:

This version of GFP is the second generation monomeric green fluorescent protein (Enhanced GFP) that has improved brightness and photostability. Recombinant GFP protein was constructed with N-terminal tag of HA2 peptide for efficient endosomal release after intracellular protein delivery, and C-terminal 9 arginine domain / His Tag, which efficiently delivery protein intracellularly.

This protein was expressed in E.coli as soluble protein and was purified using Ni-NTA Superflow column. Incubating this protein in various culture mediums at 2ug/ ml concentration could be used for monitoring intracellular protein delivery efficiency.

Gene Symbol:  GFP 
Accession Number:  AF288620
Species:  Jellyfish Aequorea Victoria
Package Size:  50 µg / Vial   
Composition: 1.0 mg/ml, sterile-filtered, in PBS buffer.
Storage: In Liquid. Keep at -20°C for long term storage. Product is stable at 4 °C for 30 days.
Key Reference: Cutler,S.R., et al. Random GFP::cDNA fusions enable visualization of subcellular structures in cells of Arabidopsis at a high frequency. Proc. Natl. Acad. Sci. U.S.A. 97 (7), 3718-3723 (2000) Hongyan Zhou, et al. Generation of Induced Pluripotent Stem Cells Using Recombinant Proteins. Cell Stem Cell. 4: 381-384 (2009).
Applications: 9 arginine tag modified GFP protein, which can be used as negative control in any transcription factor protein delivery experiments.
Quality Control: Purity: > 95% by SDS-PAGE.
Recombinant Protein Sequence: MGDIMGEWGNEIFGAIAGFLGVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITLGMDELYKSRHRRHRQRSRSRAAARRRRRRRRR
Download Datasheet