Invention in the REGENERATIVE MEDICINE is what we do every day, benefits of patients is our final goal
| Cata #: | Name of Product: | Price: |
| HTF-1211 | Recombinant Human ETV5 Protein | $300 |
| Product Name: | Recombinant Human ETV5 Protein |
| Catalog #: | HTF-1211 |
| Manufacture: | LD Biopharma, Inc. |
| Intruduction: | The protein encoded by human ETV5 gene belongs to the ETS family of transcription factors, which is a large group of evolutionarily conserved transcriptional regulators that play an important role in a variety of cellular processes throughout development and differentiation, and are involved in oncogenesis as well. Human ETV5 protein is seemingly more ubiquitously expressed in various human tissues. ETV5 plays a role in oncogenesis in various cancer development. Full-length human ETV5 cDNA (510aa, Isoform-I) was constructed with codon optimization and expressed with a small T7-His-TEV cleavage site Tag (31aa) fusion at its N-terminal. This protein is expressed in E.coli as inclusion bodies. The final product was refolded using our unique “temperature shift inclusion body refolding” technology and chromatographically purified. |
| Gene Symbol: | ETV5 (ERM) |
| Accession Number: | NP_004445.1 |
| Species: | Human |
| Package Size: | 50 µg / Vial |
| Composition: | 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol. |
| Storage: | In Liquid. Keep at -80°C for long term storage. Product is stable at 4 °C for at least 30 days. |
| Key Reference: | Power,P.F., ET AL., ETV5 as a regulator of matrix metalloproteinase 2 in human chondrosarcoma. J. Orthop. Res. 31 (3), 493-501 (2013)
O'Bryan,M.K., ET AL., Genetic variants in the ETV5 gene in fertile and infertile men with nonobstructive azoospermia associated with Sertoli cell-only syndrome. Fertil. Steril. 98 (4), 827-835 (2012) Oh,S., ET AL., ETV1, 4 and 5: an oncogenic subfamily of ETS transcription factors. Biochim. Biophys. Acta 1826 (1), 1-12 (2012) |
| Applications: | 1. May be used for in vitro ETV5 mediated oncogenesis regulation study by intracellular delivery this protein with “ProFectin” reagent. 2. May be used as ETV5 protein-protein interaction mapping. 3. As specific substrate protein for kinasw and ubiquitin (Sumo pathway) related enzyme functional screening assays. 4. Potential biomarker protein for various cancer diagnoses. 5. As antigen for specific antibody production. |
| Quality Control: | Purity: > 90% by SDS-PAGE. |
| Recombinant Protein Sequence: | MASMTGGQQMGRGHHHHHHENLYFQGGEFDGFYDQQVPFMVPGKSRSEECRGRPVIDRKRKFLDTDLAHDSEELFQDLSQLQEAWLAEAQVPDDEQFVPDFQSDNLVLHAPPPTKIKRELHSPSSELSSCSHEQALGANYGEKCLYNYCAYDRKPPSGFKPLTPPTTPLSPTHQNPLFPPPQATLPTSGHAPAAGPVQGVGPAPAPHSLPEPGPQQQTFAVPRPPHQPLQMPKMMPENQYPSEQRFQRQLSEPCHPFPPQPGVPGDNRPSYHRQMSEPIVPAAPPPPQGFKQEYHDPLYEHGVPGMPGPPAHGFQSPMGIKQEPRDYCVDSEVPNCQSSYMRGGYFSSSHEGFSYEKDPRLYFDDTCVVPERLEGKVKQEPTMYREGPPYQRRGSLQLWQFLVTLLDDPANAHFIAWTGRGMEFKLIEPEEVARRWGIQKNRPAMNYDKLSRSLRYYYEKGIMQKVAGERYVYKFVCDPDALFSMAFPDNQRPFLKAESECHLSEEDTLPLTHFEDSPAYLLDMDRCSSLPYAEGFAY Download Datasheet |