Invention in the REGENERATIVE MEDICINE is what we do every day, benefits of patients is our final goal
| Cata #: | Name of Product: | Price: |
| HRP-1137 | Recombinant Human DPT Protein | $150 |
| Product Name: | Recombinant Human DPT Protein |
| Catalog #: | HRP-1137 |
| Manufacture: | LD Biopharma, Inc. |
| Intruduction: | Human Dermatopontin (DPT) is an extracellular matrix protein with possible functions in cell-matrix interactions and matrix assembly. The protein is found in various tissues and many of its tyrosine residues are sulphated. Dermatopontin is postulated to modify the behavior of TGF-beta through interaction with decorin. Full-length mature form of human Dermatopontin (DPT) gene cDNA (19 - 201aa, derived from BC033736) was constructed with codon optimization and expressed with a small T7-His-TEV cleavage site Tag (29aa) fusion at its N-terminal. This protein is expressed in E.coli as inclusion bodies. The final product was refolded using our unique “temperature shift inclusion body refolding” technology and chromatographically purified. |
| Gene Symbol: | DPT (TRAMP) |
| Accession Number: | NP_001928.2 |
| Species: | Human |
| Package Size: | 20 µg / Vial |
| Composition: | 0.2 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol. |
| Storage: | In Liquid. Keep at -80°C for long term storage. Product is stable at 4 °C for at least 30 days. |
| Key Reference: | Yamatoji,M., et al., Dermatopontin: a potential predictor for metastasis of human oral cancer. Int. J. Cancer 130 (12), 2903-2911 (2012)
Kato,A., et al., Dermatopontin interacts with fibronectin, promotes fibronectin fibril formation, and enhances cell adhesion. J. Biol. Chem. 286 (17), 14861-14869 (2011) Li,X., et al., Dermatopontin is expressed in human liver and is downregulated in hepatocellular carcinoma. Biochemistry Mosc. 74 (9), 979-985 (2009) |
| Applications: | 1. May be used for in vitro DPT mediated TGFb activity for various cell differentiation regulation study with this protein as either coating matrix protein or as soluble factor. 2. May be used for DPT protein – protein interaction assay. 3. May be used as enzymatic substrate for various proteases. 4. Potential biomarker protein for cancer diagnosis, such as for human oral cancer. 5. May be used for specific antibody production. |
| Quality Control: | Purity: > 90% by SDS-PAGE. |
| Recombinant Protein Sequence: | MASMTGGQQMGRGHHHHHHGNLYFQGGEFGQYGDYGYPYQQYHDYSDDGWVNLNRQGFSYQCPQGQVIVAVRSIFSKKEGSDRQWNYACMPTPQSLGEPTECWWEEINRAGMEWYQTCSNNGLVAGFQSRYFESVLDREWQFYCCRYSKRCPYSCWLTTEYPGHYGEEMDMISYNYDYYIRGATTTFSAVERDRQWKFIMCRMTEYDCEFANV Download Datasheet |