Invention in the REGENERATIVE MEDICINE is what we do every day, benefits of patients is our final goal
| Cata #: | Name of Product: | Price: |
| HRP-1124 | Recombinant Human CD34 Protein | $150 |
| Product Name: | Recombinant Human CD34 Protein |
| Catalog #: | HRP-1124 |
| Manufacture: | LD Biopharma, Inc. |
| Intruduction: | The protein encoded by human CD34 gene may play a role in the attachment of stem cells to the bone marrow extracellular matrix or to stromal cells. This single-pass membrane protein is highly glycosylated and phosphorylated by protein kinase C. Two transcript variants encoding different isoforms have been found for this gene. Full-length extracellular domain of human CD34 cDNA (32 – 290 aa, derived from BC039146) was constructed with codon optimization and expressed with a small T7-His-TEV cleavage site Tag (29aa) fusion at its N-terminal. This protein is expressed in E.coli as inclusion bodies. The final product was refolded using our unique “temperature shift inclusion body refolding” technology and chromatographically purified. |
| Gene Symbol: | CD34 |
| Accession Number: | NP_001764 |
| Species: | Human |
| Package Size: | 50 µg / Vial |
| Composition: | 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol. |
| Storage: | In Liquid. Keep at -80°C for long term storage. Product is stable at 4 °C for at least 30 days. |
| Key Reference: | Koh,Y., et al., The lack of CD34 expression in gastrointestinal stromal tumors is related to cystic degeneration following imatinib use. Jpn. J. Clin. Oncol. 42 (11), 1020-1027 (2012)
Ajili,F., et al., Prognostic impact of angiogenesis in nonmuscle invasive bladder cancer as defined by microvessel density after immunohistochemical staining for CD34. Ultrastruct Pathol 36 (5), 336-342 (2012) Satterthwaite,A.B., et al., Structure of the gene encoding CD34, a human hematopoietic stem cell antigen. Genomics 12 (4), 788-794 (1992) |
| Applications: | 1. May be used for in vitro CD34 mediated HSC differentiation regulation study with this protein as either coating matrix protein or soluble factor. 2. May be used as CD34 protein-protein interaction assay. 3. Potential diagnostic biomarker for various cancer treatment selections. 4. As antigen for specific antibody production. |
| Quality Control: | Purity: > 90% by SDS-PAGE |
| Recombinant Protein Sequence: | MASMTGGQQMGRGHHHHHHGNLYFQGGEFSLDNNGTATPELPTQGTFSNVSTNVSYQETTTPSTLGSTSLHPVSQHGNEATTNITETTVKFTSTSVITSVYGNTNSSVQSQTSVISTVFTTPANVSTPETTLKPSLSPGNVSDLSTTSTSLATSPTKPYTSSSPILSDIKAEIKCSGIREVKLTQGICLEQNKTSSCAEFKKDRGEGLARVLCGEEQADADAGAQVCSLLLAQSEVRPQCLLLVLANRTEISSKLQLMKKHQSDLKKLGILDFTEQDVASHQSYSQKT Download Datasheet |