Invention in the REGENERATIVE MEDICINE is what we do every day, benefits of patients is our final goal
| Cata #: | Name of Product: | Price: |
| HRP-1064 | Recombinant Human CD23 Protein | $125 |
| Product Name: | Recombinant Human CD23 Protein |
| Catalog #: | HRP-1064 |
| Manufacture: | LD Biopharma, Inc. |
| Intruduction: | The protein encoded by human CD23 gene is a B-cell specific antigen, and a low-affinity receptor for IgE. It has essential roles in B cell growth and differentiation, and the regulation of IgE production. This protein also exists as a soluble secreted form, then functioning as a potent mitogenic growth factor. Alternatively spliced transcript variants encoding different isoforms have been described for this gene. Full-length extracellular domain of human CD23 cDNA (48 - 321 aa, Isoform_A, derived from BC062591) was constructed with codon optimization and expressed with a small T7-His-TEV cleavage site Tag (29aa) fusion at its N-terminal and expressed in E.coli as inclusion bodies. The final product was refolded using our unique “temperature shift inclusion body refolding” technology and chromatographically purified. |
| Gene Symbol: | CD23 (FCER2; CLEC4J; FCE2; IGEBF) |
| Accession Number: | NP_001993 |
| Species: | Human |
| Package Size: | 50 µg / Vial |
| Composition: | 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol. |
| Storage: | In Liquid. Keep at -80°C for long term storage. Product is stable at 4 °C for at least 30 days. |
| Key Reference: | Edkins,A.L., et al., Differential regulation of monocyte cytokine release by alphaV and beta(2) integrins that bind CD23. Immunology 136 (2), 241-251 (2012)
Borthakur,S., et al., Mapping of the CD23 binding site on immunoglobulin E (IgE) and allosteric control of the IgE-Fc epsilonRI interaction. J. Biol. Chem. 287 (37), 31457-31461 (2012) Edkins,A.L., et al., Analysis of the CD23-alphav integrin interaction: a study with model peptides JOURNAL Biochem. Biophys. Res. Commun. 422 (2), 207-212 (2012) |
| Applications: | 1. May be used for in vitro human CD23-integrin chain mediated monocyte cytokine regulation study with this protein as either coating matrix protein or soluble factor. 2. May be used for protein-protein interaction assay development. 3. As antigen for specific antibody production. |
| Quality Control: | 1. Purity: > 90% by SDS-PAGE. |
| Recombinant Protein Sequence: | MASMTGGQQMGRGHHHHHHGNLYFQGGEFEDTTQSLKQLEERAARNVSQVSKNLESHHGDQMAQKSQSTQISQELEELRAEQQRLKSQDLELSWNLNGLQADLSSFKSQELNERNEASDLLERLREEVTKLRMELQVSSGFVCNTCPEKWINFQRKCYYFGKGTKQWVHARYACDDMEGQLVSIHSPEEQDFLTKHASHTGSWIGLRNLDLKGEFIWVDGSHVDYSNWAPGEPTSRSQGEDCVMMRGSGRWNDAFCDRKLGAWVCDRLATCTPPASEGSAESMGPDSRPDPDGRLPTPSAPLHS Download Datasheet |